Protein Info for MMJJ_RS04650 in Methanococcus maripaludis JJ

Annotation: nitrogenase iron protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF13614: AAA_31" amino acids 1 to 85 (85 residues), 45.4 bits, see alignment E=2.1e-15 PF02374: ArsA_ATPase" amino acids 1 to 44 (44 residues), 40 bits, see alignment 7.1e-14 TIGR01287: nitrogenase iron protein" amino acids 2 to 284 (283 residues), 408.7 bits, see alignment E=5.4e-127 PF00142: Fer4_NifH" amino acids 2 to 277 (276 residues), 335.4 bits, see alignment E=7.1e-104 PF01656: CbiA" amino acids 6 to 235 (230 residues), 46.8 bits, see alignment E=7e-16

Best Hits

Swiss-Prot: 77% identical to NIFH2_METTL: Nitrogenase iron protein 2 (nifH2) from Methanothermococcus thermolithotrophicus

KEGG orthology group: K02588, nitrogenase iron protein NifH [EC: 1.18.6.1] (inferred from 99% identity to mmp:MMP0147)

Predicted SEED Role

"Nitrogenase subunit NifH paralog, type 1"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>MMJJ_RS04650 nitrogenase iron protein (Methanococcus maripaludis JJ)
MKQIAFYGKGGIGKSTTVCNLAAALSKSGKKVIVVGCDPKHDCTSNLRSGEDIPTVLDVL
REKGIDKLGIETIIRENLLKKEDIIYEGFNGIYCVEAGGPKPGYGCAGRGVIVVIDLLKK
MNVFEDLGVDVVLYDVLGDVVCGGFAMPLRMGLADQIYVVTSSDYMALYAANNICSGISQ
FVKRGGSTLGGIIYNVRGSMDAFDIVSEFANQLNANIIGKVPNSPIINEAEIDGQTAIEY
APEEEISKIYMELAESIYQNTTGTTPNPLENAQIMQIGKMIKERIKKQKITE