Protein Info for MMJJ_RS04560 in Methanococcus maripaludis JJ

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details PF01061: ABC2_membrane" amino acids 4 to 215 (212 residues), 123.3 bits, see alignment E=1e-39 TIGR01247: daunorubicin resistance ABC transporter membrane protein" amino acids 10 to 247 (238 residues), 319.3 bits, see alignment E=8.3e-100 PF12698: ABC2_membrane_3" amino acids 58 to 245 (188 residues), 54.1 bits, see alignment E=1.4e-18

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 99% identity to mmp:MMP0165)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>MMJJ_RS04560 ABC transporter permease (Methanococcus maripaludis JJ)
MDAFSAMFYRQLRRFTRAKSRVLGSLLNPLVWLVFFGIGWSRAFDFPAAREIFGGVDYLT
YLIPGVVSMTVFSGSFISGVTVIWDKQFGFLKETLVAPTSRSEAILGRIMGDSITALIQG
VLIMVLSLFLVSLNPFGMIPVIFTSFILAVAFASVGISLGLKINSQEGFHLIFGLLMQPL
IFLSGAFYPIDAMPTWMKILAYLNPLTYAVDSARYFLAGFSRFPIILDVSILIVLSVFLV
VLAMYTFEKAVIE