Protein Info for MMJJ_RS04535 in Methanococcus maripaludis JJ

Annotation: coenzyme gamma-F420-2:alpha-L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR04443: coenzyme gamma-F420-2:alpha-L-glutamate ligase" amino acids 2 to 284 (283 residues), 531.9 bits, see alignment E=2.9e-164 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 4 to 277 (274 residues), 156.3 bits, see alignment E=1e-49 PF08443: RimK" amino acids 92 to 278 (187 residues), 182.2 bits, see alignment E=2.1e-57 PF02655: ATP-grasp_3" amino acids 92 to 259 (168 residues), 43.7 bits, see alignment E=7.8e-15 PF02955: GSH-S_ATP" amino acids 108 to 257 (150 residues), 36 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 97% identical to COFF_METMP: Coenzyme gamma-F420-2:alpha-L-glutamate ligase (cofF) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K14940, gamma-F420-2:alpha-L-glutamate ligase [EC: 6.3.2.32] (inferred from 97% identity to mmp:MMP0170)

MetaCyc: 61% identical to gamma-F420-2:alpha-L-glutamate ligase (Methanocaldococcus jannaschii)
RXN-8087 [EC: 6.3.2.32]

Predicted SEED Role

"Coenzyme gamma-F420-2:L-glutamate ligase" in subsystem Coenzyme F420 synthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>MMJJ_RS04535 coenzyme gamma-F420-2:alpha-L-glutamate ligase (Methanococcus maripaludis JJ)
MITIACAEGGSTIYSLKKAIEDLGEKCNILLLSSDNLLVDTDFNIETDLIHSRCGIGDYL
DRLTLFSWQVLKNLESEGHYFINPLETIYNSSDKFKTTKILSKNGLKTPKTALIRDYGDA
KHFLDITNIDYPVILKNSFSKCGMKVQKANSDDELQELSKNSIWESKLIQEYVDFKKGDT
YKDMRILVIDGEVVGGYRRVSNNFITNLYVGGQIEPLNVSSELEEIALKCSECMNGYIMG
IDILPKDGEYYVVEVNTAPGTKGFRSLGIDVDKRIAECLIKYKKS