Protein Info for MMJJ_RS04485 in Methanococcus maripaludis JJ

Annotation: riboflavin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 3 to 130 (128 residues), 63.2 bits, E=1.3e-21
• TIGR01506: riboflavin synthase
  • amino acids 4 to 152 (149 residues), 224.6 bits, E=2.6e-71

Best Hits

Swiss-Prot: 83% identical to RISC_METJA: Riboflavin synthase (ribC) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 99% identity to mmp:MMP0180)

MetaCyc: 83% identical to riboflavin synthase monomer (Methanocaldococcus jannaschii)
Riboflavin synthase. [EC: 2.5.1.9]

Predicted SEED Role

"Riboflavin synthase archaeal (EC 2.5.1.9)" in subsystem Riboflavin, FMN and FAD metabolism (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis II (archaea) (8/10 steps found)
• flavin biosynthesis I (bacteria and plants) (6/9 steps found)
• flavin biosynthesis III (fungi) (5/9 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Protein Sequence (156 amino acids)

>MMJJ_RS04485 riboflavin synthase (Methanococcus maripaludis JJ)
MTVKVGIADTTFARVDMASAAIKKLNEMTSNIKIIRYTVPGMKDLPVACKKLMEEQGCEI
TMALGMPGGKDKDKVCAHEASQGLMMAQLMTNKHIIEVFVHEDEAKDGKELDWLAKRRAE
EHAENVYYMLFKPEFLQKSAGKGLRQGFEDAGAARK