Protein Info for MMJJ_RS04335 in Methanococcus maripaludis JJ

Annotation: minichromosome maintenance protein MCM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 PF17207: MCM_OB" amino acids 102 to 204 (103 residues), 62 bits, see alignment E=1.2e-20 PF00493: MCM" amino acids 259 to 477 (219 residues), 238.7 bits, see alignment E=1.1e-74 PF07728: AAA_5" amino acids 311 to 430 (120 residues), 24.3 bits, see alignment E=6.9e-09 PF01078: Mg_chelatase" amino acids 359 to 458 (100 residues), 25.7 bits, see alignment E=1.8e-09 PF17855: MCM_lid" amino acids 505 to 582 (78 residues), 87.4 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: K10726, replicative DNA helicase Mcm [EC: 3.6.4.-] (inferred from 84% identity to mmq:MmarC5_1119)

Predicted SEED Role

"DNA replication helicase protein MCM" in subsystem DNA replication, archaeal

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (674 amino acids)

>MMJJ_RS04335 minichromosome maintenance protein MCM (Methanococcus maripaludis JJ)
MDDKIKSKLMSRLVPYFKEVHLDDIISETKRVVVDLKNVHDYGFFEFLDYLEENPYSALE
LLNEAYADAYFSYKMADADCTVTVKNLPESLNRNSNGKPMTIEDIKGENYGKLVEVEGIV
VMATKIKLALKEAVYVCASCGQKKKVTIERPFEMHMGPQCPKCSQNMLLLDEESKYVDYQ
ELKIQQPLDLMDDPEDPPKFISVLLEYTPGIYCGRIKVTGIPIKNQKNKKIPLHDILIGG
YNCEPVTEKLDVSFTENEIKQFESLAKNKDVLNILSGRIAPQIKGNEIIKQSILLQQVRG
VKKGKKRADSHILLITDPGTGKSDILRFIAGVPGCVYSSISTASGVGLTAGVVQEKTEIG
DSTWVIKPGVLVKANGGTACLDELTVERSVLSYILEAMESQTIHVSKGGLNTKLPAGCSI
LAACNPKYGRYDKNIPVIEQINIPAPLLSRFDLIFPIKDTPNRKRDSEIANHILDTHIAY
MDDSKNKEIGLFYEIIDEIKIDFDFFCKYIAYARQKTPKFTKESKQVIHDFYLDLRKSSV
QITARQLEALVRLSEAHAKLKLKDLVEEEDAKFAIYLMTESLKEVAYDQKTKSFDIDRLF
GNSKVERNELNVVYDIIRLQCENSEHNLAKKISIIKRALEYDISDGKAVKLIDKLIGFGD
IEEISAGTYRMKGV