Protein Info for MMJJ_RS04225 in Methanococcus maripaludis JJ

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF00248: Aldo_ket_red" amino acids 16 to 268 (253 residues), 148.9 bits, see alignment E=5.1e-47 PF13183: Fer4_8" amino acids 294 to 364 (71 residues), 30.3 bits, see alignment E=1.6e-10 PF13534: Fer4_17" amino acids 294 to 365 (72 residues), 29.6 bits, see alignment E=2.5e-10 PF13187: Fer4_9" amino acids 294 to 363 (70 residues), 37.8 bits, see alignment E=4.9e-13

Best Hits

KEGG orthology group: K07079, (no description) (inferred from 97% identity to mmp:MMP0208)

Predicted SEED Role

"Aldo/keto reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>MMJJ_RS04225 aldo/keto reductase (Methanococcus maripaludis JJ)
MQYREIKKTGDKISALGFGAMRLPTKNGSIDKEKAKKQIYYAIDNGVNFIDTAFPYHGGA
SESFLGEILSENYRNKIKLSTKLPQWQVKKYEDMEMYLDTQLKKLNTDFIDYYFIHSLSK
DSWAKMKDLGVLKFLEEAKKSGKIKYACFSYHDNTETFKEIIDAYDWDACLIQYNYLDEQ
NQAGTKGLNYAASKGIGVFIMEPLRGGNLSKKVPKEAEEIFNSYEIKRTPADWALRWVLN
HPEVTCVLSGMNEESHVKENLKVASETTPDSLSNEELEIYDKVKNVYRKLMKINCTGCGY
CMPCPFGVDIPACFSMYNEKSIFNDKKTGFLYLARLGGVMGGEESHAGLCTNCGKCVKSC
PQNLDIPALLKDVSTELGGSGFNLKIKLAKIAMSIYSSFNSLKQKISKN