Protein Info for MMJJ_RS04165 in Methanococcus maripaludis JJ

Annotation: sodium:solute symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 322 to 350 (29 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 395 to 418 (24 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details amino acids 451 to 473 (23 residues), see Phobius details PF00474: SSF" amino acids 31 to 430 (400 residues), 189.2 bits, see alignment E=5.9e-60

Best Hits

KEGG orthology group: None (inferred from 98% identity to mmp:MMP0220)

Predicted SEED Role

"Sodium/proline symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>MMJJ_RS04165 sodium:solute symporter (Methanococcus maripaludis JJ)
MWHYVFLAVYIAMIIGIATITKKRIKGVSDFLLGGRNVNPWMSAFSYGTAYFSAVIFIGF
AGKMGWSFGIPTMWIVVGNTIIGSFLAWQVLGKKTREMTQRLGASTMPSFLEKRYKSKNL
ESLTAFIIFFFLVPYSASIYKGLNFLFEGFGISPMNAYILMAALTAIYLYFGGFIAATLA
DFVQGCIMVIGVLLMVFFLGSNPEVGGFFGMLSNLSSIDPMLVTPINEASFIPIMGLALL
TSIGSWGLPQMIHKFYTIKSEKAAVSAKWVSTAFAFIITFGAAYIGTVSRVFYPDSASKA
AAGLTSPDMIVPKIMEIALPDWVAALILVLVISASMSTLASLVLASSSVVSIDFVKGRLK
TDLSDRNTMILMRLLCVLFVVLSFILAIVPNSYVLSLMALSWGLVSGCLLAPYFLGLYWK
RTTKQGVWAGITSALVIMFGGAYYFGINSVYMPAVGSLAMIAPIFVVMAVSLITKPFESE
HLDYIFNKK