Protein Info for MMJJ_RS04040 in Methanococcus maripaludis JJ

Annotation: prefoldin subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 TIGR02338: prefoldin, beta subunit" amino acids 3 to 110 (108 residues), 111.1 bits, see alignment E=1.3e-36 PF01920: Prefoldin_2" amino acids 8 to 111 (104 residues), 96.1 bits, see alignment E=5.9e-32

Best Hits

Swiss-Prot: 100% identical to PFDB_METMP: Prefoldin subunit beta (pfdB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K04798, prefoldin beta subunit (inferred from 100% identity to mmp:MMP0245)

Predicted SEED Role

"Prefoldin beta subunit (GimC beta subunit)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>MMJJ_RS04040 prefoldin subunit beta (Methanococcus maripaludis JJ)
MELPANVQNQLMQFQQLQQQLQMIMYQKQQFETQLKEMEKAIEEMEKSDSEEVFKMAGGI
LVKRNKAEVKEELSEKIETLQLRVTTFEKQEEKMQKRYTELQESLQKVMGQGQ