Protein Info for MMJJ_RS03905 in Methanococcus maripaludis JJ

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 23 to 167 (145 residues), 54.1 bits, E=1.3e-18

Best Hits

Swiss-Prot: 80% identical to Y121_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0121 (MJ0121) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 96% identity to mmz:MmarC7_1276)

Predicted SEED Role

"Uncharacterized ABC transporter ATP-binding protein MJ0121"

Protein Sequence (263 amino acids)

>MMJJ_RS03905 ATP-binding cassette domain-containing protein (Methanococcus maripaludis JJ)
MNIEEIKIIGGFNKFGESEKVTELVVKRGEIFGVVGPTGSGKSNLISDIEQLAQGDTPSN
RKILVNGKVPDVEMRRDPRKRRIAQLSQNMNFLADMTVEEFLIMHAKSRGMNSEGIVDRV
IELANKLTGEPIEKDYNLTILSGGQSRSLMVADVAVISDSPIVLIDEIENAGIKKHEALE
LLAGCGKIVMVITHDPVLALMTTRRVVMRNGGMTEIIETTEEEKEVSQRLSEIDSWMLSM
REKVRHGEKLNLKDIETPAVSGN