Protein Info for MMJJ_RS03890 in Methanococcus maripaludis JJ

Annotation: right-handed parallel beta-helix repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 925 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF05048: NosD" amino acids 33 to 187 (155 residues), 45.7 bits, see alignment E=8e-16 amino acids 166 to 364 (199 residues), 146 bits, see alignment E=1.6e-46 PF13229: Beta_helix" amino acids 50 to 190 (141 residues), 37.4 bits, see alignment E=3e-13 amino acids 166 to 290 (125 residues), 65 bits, see alignment E=9.5e-22 amino acids 228 to 334 (107 residues), 40.1 bits, see alignment E=4.6e-14 TIGR03804: parallel beta-helix repeat" amino acids 117 to 160 (44 residues), 41.6 bits, see alignment 3.8e-15 amino acids 168 to 211 (44 residues), 40.6 bits, see alignment 8e-15 amino acids 260 to 302 (43 residues), 36 bits, see alignment 2.1e-13 PF17957: Big_7" amino acids 405 to 474 (70 residues), 41.9 bits, see alignment 2e-14 amino acids 595 to 662 (68 residues), 43.3 bits, see alignment 7.1e-15

Best Hits

KEGG orthology group: None (inferred from 86% identity to mmp:MMP0275)

Predicted SEED Role

"Cell surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (925 amino acids)

>MMJJ_RS03890 right-handed parallel beta-helix repeat-containing protein (Methanococcus maripaludis JJ)
MKIFKVFLVMVILGAISGVCAEDTTIYVNNTHYWYQSGAFFESNNSIQDAIENVPENGIV
EVTTDLKVSNGIEINKSNIIIDLKGNKLSGNYEGRGISISGNNVSLKNGIVSNFDYGIVL
ENAENCKISNNEVFGNTYDGIYILNSKNNDISENLVYENGVIGIVTSGIFLDGSEFNNIT
KNTVNNNIYNGIELLNSKNNLISGNTVFENEDNGVFVWDSKNNSIIFNELYQNENNGILT
RESEFNNIESNNIFENDDSGIYSWKSFENTISKNKISKNSEGIILWNSDLNVLFKNRLLN
NVKSGIFMEFGTKYNTIYDNLFNNSLNVRFEDSGENYWNAPIINESNILEGEFTAGNVWY
TPEGTGFSQKAMNQDSNGDTLSETYYELNSENIDNIPLAPDSVPPVVSIVSPRENAFFGE
NETILVDVSVTDNSEIHSVMLEVDNSYKEIMVQNGTTYSKSLDNLDYGAHTIKIYAKDAV
GNVNSFESRVFSISTPDSTPPEVKIISPVSKSYAEGSEVSIKVKITDESDIYSAYAKIDD
YTVDLIESNGYYINILDNLEWGAHTLWIIVTDAAGNSNYNEKVTFDVNEGDITPPEVEII
EPEIGDSFEENVSVKVSATDDSGIDSVKVMLDEKVSFTLTKSSNYYTGTLTDLSYGIHTL
RVYAEDNEENINSDEVIQFEIDVPDYSYTKPITDDTQEPAETSNPENKTTDTPLNNETGE
ITPNESENESNGEIENNTDESQNNETQNNTDAEDEGNISDNPSENDSPLEPEDSGSADSG
DTSDTEPDNNDEGAEDSGDNPSETGEATGDESSETSPDDETQSNDETGESETSDDEQSET
PSETEDITGDESSETSSGDNSDTTSDDNPGGESESNSETEDSETSDDEPSDSSSESESNS
DTSSEDNSGSETSDSSPDESENPVA