Protein Info for MMJJ_RS03870 in Methanococcus maripaludis JJ

Annotation: beta-ribofuranosylaminobenzene 5'-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR00144: beta-ribofuranosylaminobenzene 5'-phosphate synthase family" amino acids 2 to 324 (323 residues), 448.1 bits, see alignment E=8.9e-139 PF00288: GHMP_kinases_N" amino acids 87 to 144 (58 residues), 23.6 bits, see alignment E=5.9e-09 PF08544: GHMP_kinases_C" amino acids 227 to 301 (75 residues), 25.7 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 61% identical to RFAPS_METJA: Beta-ribofuranosylaminobenzene 5'-phosphate synthase (MJ1427) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06984, (no description) (inferred from 98% identity to mmp:MMP0279)

MetaCyc: 61% identical to RFA-P synthase monomer (Methanocaldococcus jannaschii)
RXN-22578 [EC: 2.4.2.54]; 2.4.2.54 [EC: 2.4.2.54]

Predicted SEED Role

"beta-ribofuranosylaminobenzene 5'-phosphate synthase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>MMJJ_RS03870 beta-ribofuranosylaminobenzene 5'-phosphate synthase (Methanococcus maripaludis JJ)
MKLNSPSRIHMGLIDLNGEIGRVDGGVGVALDYPNFQIEGKESSEIEIDFRIEIYEKDKE
NLESRIKNAAKNVLDVIGESGISLKVNDAILSHSGLGSGTQVSLSTGKITSLVYGVDLNA
ETLAKITGRGGTSGIGVAAFETGGFIVDGGHTFGEGKDKIDFRPSSASKDVKPSPVLFRH
DFDWDIVLTIPKGEQVCGDREVDIFRKFCPVPTEDVQKICRLVLMKMMPAVIEKDFDSFG
KVVNELQNLGFKRAEVGLQKESLKGLLSKLQEVSYSGISSFGPTIYSLGDKDTITEISNE
FFDKFGIEGEIISTKANNSGYEIIK