Protein Info for MMJJ_RS03860 in Methanococcus maripaludis JJ

Annotation: PINc/VapC family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 PF01850: PIN" amino acids 22 to 135 (114 residues), 39.4 bits, see alignment E=1.3e-13 PF00437: T2SSE" amino acids 230 to 387 (158 residues), 40.3 bits, see alignment E=3.1e-14 PF00013: KH_1" amino acids 503 to 545 (43 residues), 29 bits, see alignment 1.1e-10

Best Hits

Swiss-Prot: 66% identical to Y1533_METJA: Uncharacterized KH and PIN-domain containing protein MJ1533 (MJ1533) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06865, ATPase (inferred from 98% identity to mmp:MMP0281)

Predicted SEED Role

"KH domain-containing protein MJ1533"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>MMJJ_RS03860 PINc/VapC family ATPase (Methanococcus maripaludis JJ)
MSIEEINQNLNENKKFKECKITVDTCVVIDGRITELILDGRIEKCKIIVPEAVISELEAQ
ANKGREIGYFGIEELKKLVTVAKENEILLEYYGERPSTGEVSLARAGEIDAMIRKVAKDT
DSILFTSDKIQYNLAIAQNISAHFLKVHEEKVDLKLIEYFDEITSSVHLKENCLPYVKKG
RPGKVRLIPFADEIMNRTEIKVIIDNILKYTEQNHGLVEIERRGATVIQLGNLRISIARP
PFSEALEVTAVRPITKVSLEDYNLSEDLKVRLDSAEGIFVSGAPGSGKSTFVSALAERYK
NMDKIVKTMESPRDLQVDEEITQYAPLEGSMEKTCDILLLVRPDYTIYDEVRKTKDFEIF
ADMRMAGVGMVGVVHASKAIDSIQRLIGRVELGIIPQIVDTVVFIENGKIGKVYEVEFNV
KVPHGMKEADLARPVIEVVDFLTKTPEYEIYTYGEQVVVMPIKETTESRGAVLAYAEEKI
SEVLKKHLPKKSRPDIRVVNKDTVEVKVLEKFIPAIIGKGGKEISKLEEITGLRISVGEK
DEFVENEKDFETYEFINDYESTKLSQTGKHVIVELGEDYIGANIKIYIDGEYACTATVSS
NGTVNISKKTAIGKDLASAMKKGKDIYVEF