Protein Info for MMJJ_RS03845 in Methanococcus maripaludis JJ

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 TIGR00491: translation initiation factor aIF-2" amino acids 3 to 597 (595 residues), 933 bits, see alignment E=7.1e-285 TIGR00231: small GTP-binding protein domain" amino acids 6 to 147 (142 residues), 67.3 bits, see alignment E=1.4e-22 PF00009: GTP_EFTU" amino acids 6 to 215 (210 residues), 111.7 bits, see alignment E=8.6e-36 PF01926: MMR_HSR1" amino acids 8 to 131 (124 residues), 32.3 bits, see alignment E=2.3e-11 PF11987: IF-2" amino acids 335 to 444 (110 residues), 72.9 bits, see alignment E=5.3e-24 PF14578: GTP_EFTU_D4" amino acids 466 to 553 (88 residues), 95.8 bits, see alignment E=2.9e-31

Best Hits

Swiss-Prot: 100% identical to IF2P_METMP: Probable translation initiation factor IF-2 (infB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03243, translation initiation factor 5B (inferred from 100% identity to mmp:MMP0284)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (598 amino acids)

>MMJJ_RS03845 translation initiation factor IF-2 (Methanococcus maripaludis JJ)
MALRCPIVSVLGHVDHGKTSLLDKIRRTRVTQREAGGITQHIGASEIPINTIKKVSKDLL
GLFKADLSIPGILVIDTPGHEAFTSLRKRGGALADIAILVVDINEGFKPQTIEAINILKQ
CKTPFVVAANKVDRIPGWNSSEGPFILNFNEKNQHPNAMTEFEIRLYENVIKHLNELGFD
ADLFSRVKDTTKTINVVPVSAMTGEGVPDLLVIISGLAQRFLEQKLALNVEGYAKGTVLE
LKEEKGLGKTIDAIIYDGIAKTGDFLVVGNPDGVLVSKIKALLKPKELDEMRDPKDKFKP
SKQISAATGVKISAPDLDSVIAGSPLRIVPKNQVEAAKEEVLEEVEEFTILTDDEGIIIK
ADTMGSLEALANELRKVNAKIKKAEVGDISKKDVIEASSYASTNPLNGLIISFNTKVLAD
AKAEIEKSDVKLLEGKIIYKLVEEHEEWTKEMEELMKSDEINRLTKPAMIKILPNCIFRQ
KEPAVCGVEVLYGTLKIGSPIMSEDGKKLGYVKEMRDNQQENIKEAKVGMQVPVSIDGNI
VLGRNAKENDILYVEVPEPEARKLHHEFKDELRGDEKEALSRYMELKQKIENNIFWGM