Protein Info for MMJJ_RS03830 in Methanococcus maripaludis JJ
Annotation: CBS domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to Y188_METJA: Uncharacterized protein MJ0188 (MJ0188) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to mmp:MMP0287)Predicted SEED Role
"CBS/parB domain-containing protein"
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
- guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
- superpathway of purine nucleotide salvage (10/14 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
- inosine 5'-phosphate degradation (2/4 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis II (4/8 steps found)
- purine nucleotides degradation II (aerobic) (6/11 steps found)
- adenosine nucleotides degradation I (3/8 steps found)
- ureide biosynthesis (2/7 steps found)
- purine nucleotides degradation I (plants) (4/12 steps found)
- superpathway of purines degradation in plants (4/18 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Drug metabolism - other enzymes
- Purine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.205
Use Curated BLAST to search for 1.1.1.205
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (264 amino acids)
>MMJJ_RS03830 CBS domain-containing protein (Methanococcus maripaludis JJ) MVYAEEYMTKKVHSITPDATVSDIIKLVKETTHDTFPVVVNSKVKGIVSVHDLIGKDESD EVSEFMTPRDDMIVTKPHTKIMDVGRIMFRTGFSKLPIVDENNNILGIITNTDVIRSQIE KTTPKKLKKIVNSYINLGYEVTTKRETIQIDDLIPTQANVYEDELYGRAYELKRGLAEPI IVIKTNVNEKYILVDGHHRAVAACLSNIKELEAHVLEINTDKTMGIEKTAEKQGLKSLKD IKILDEEKMNCSSAYKLRANILEL