Protein Info for MMJJ_RS03825 in Methanococcus maripaludis JJ

Annotation: DUF1624 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 212 to 238 (27 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 6 to 228 (223 residues), 229.3 bits, see alignment E=2.1e-72

Best Hits

KEGG orthology group: None (inferred from 96% identity to mmp:MMP0288)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>MMJJ_RS03825 DUF1624 domain-containing protein (Methanococcus maripaludis JJ)
MQKTGRFLEIDFFRGLAIILMVISNFVTDLKYFLGYSEYLLFWSFFALFVASSFVFISGV
SFNVSFSKKVASQNLTYKSYLDRFLKLSVIAVVITAVTAYFLTSGTIYFGIMHFLAISGI
LGIIFYRFKKLNLFFSVIFLILGVLFSEVVLDTYWLLPLGILPTNFYTLDYFPIFPWFGV
YLLGMSFSEKYYKNGVSRHSFEIFKNRFFNKICILGQNTLIIYIIHQPVLVGILILKYGI
FSKIAL