Protein Info for MMJJ_RS03740 in Methanococcus maripaludis JJ

Annotation: thiamine pyrophosphate-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR02177: 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family" amino acids 15 to 281 (267 residues), 360.9 bits, see alignment E=2.6e-112 PF02775: TPP_enzyme_C" amino acids 54 to 196 (143 residues), 103.7 bits, see alignment E=8.3e-34 PF12367: PFO_beta_C" amino acids 200 to 260 (61 residues), 82.8 bits, see alignment E=1.4e-27

Best Hits

KEGG orthology group: K00175, 2-oxoglutarate ferredoxin oxidoreductase subunit beta [EC: 1.2.7.3] (inferred from 99% identity to mmp:MMP0305)

Predicted SEED Role

"2-oxoglutarate oxidoreductase, beta subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MMJJ_RS03740 thiamine pyrophosphate-dependent enzyme (Methanococcus maripaludis JJ)
MENSLFQRTEKLDISWCPGCGNFAIKASLSNALTELNLKPENVAIISGIGQAGKMPHYIK
VNGFHTLHGRAIPAATAVKATNPNLTVIAEGGDGDMYAEGGNHLIHAIRRNPNITVLIHN
NQIYGLTKGQASPTTLISTKTPTQPWGVFEEPLNPIALAISLNASFVARTFSGNLEKTKE
IIIKAINHKGLSIVDIFHPCPSFNKLNTLQWYKENTYFLEDHDVTNRKKAFEKSLETEKY
PLGIFYTCEKPVFEEVVPPYISEKTPIWKREPNLEKIEEIINLKRS