Protein Info for MMJJ_RS03555 in Methanococcus maripaludis JJ

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit
  • amino acids 1 to 443 (443 residues), 696 bits, E=1.1e-213
• PF00289: Biotin_carb_N
  • amino acids 1 to 110 (110 residues), 158.2 bits, E=3.2e-50
• PF02655: ATP-grasp_3
  • amino acids 115 to 293 (179 residues), 28.8 bits, E=4.2e-10
• PF02786: CPSase_L_D2
  • amino acids 116 to 321 (206 residues), 274.6 bits, E=1.8e-85
• PF02222: ATP-grasp
  • amino acids 136 to 292 (157 residues), 37.2 bits, E=8.4e-13
• PF08443: RimK
  • amino acids 138 to 312 (175 residues), 28.8 bits, E=3.2e-10
• PF07478: Dala_Dala_lig_C
  • amino acids 138 to 290 (153 residues), 51.2 bits, E=4.2e-17
• PF02785: Biotin_carb_C
  • amino acids 335 to 441 (107 residues), 132.6 bits, E=2.2e-42

Best Hits

Swiss-Prot: 70% identical to PYCA_METJA: Pyruvate carboxylase subunit A (pycA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01959, pyruvate carboxylase subunit A [EC: 6.4.1.1] (inferred from 100% identity to mmp:MMP0341)

MetaCyc: 100% identical to pyruvate carboxylase subunit A (Methanococcus maripaludis)
Pyruvate carboxylase. [EC: 6.4.1.1]

Predicted SEED Role

"Pyruvate carboxyl transferase subunit A (EC 6.4.1.1)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 6.4.1.1)

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• gluconeogenesis III (9/12 steps found)
• reductive TCA cycle I (6/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (3/13 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Citrate cycle (TCA cycle)
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.1

Use Curated BLAST to search for 6.4.1.1

Protein Sequence (501 amino acids)

>MMJJ_RS03555 acetyl-CoA carboxylase biotin carboxylase subunit (Methanococcus maripaludis JJ)
MFKKVLIANRGEIAVRVIRACKELGIKTVAVFSEADEHSLYRNIADECYPIGEPPASKSY
LNMERILKVAEKAGVDAVHPGYGFLSENVKFADECHKRGIEFIGPPTNAIDVMGSKINAK
KAMKTAGVPVLPGREEAIESEEEAIEVADEIGYPVIIKASAGGGGIGMNVVYNKEELVDT
IQSTKSIAQSAFGDSTVFIEKYLEKPRHIEIQVVADKFGNVIHLGDRECSIQRRHQKLIE
ESPSPIMTEELRERMGNAAVKAAKAINYHSVGTVEFLYSKGEFYFLEMNTRVQVEHPITE
VVTGVDIVKEQIKIAAGKKLSYKQDEITFRGHAIECRVNAEDAINDFVPAPGKIKYYRSP
GGPGVRLDSGVFGGAEIPPYYDSMVAKIITYGLTREEAIERMKRALSEYMVLGIITNIPF
HRAVIEEDNFLKGNLSTHYVEDNLCSFRKAMVNYALEAKDREKIFSEKVFHGNKKVIAIA
GGLNAYITSLSNKNKDKYDKN