Protein Info for MMJJ_RS03515 in Methanococcus maripaludis JJ

Annotation: GPR1/FUN34/YaaH family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 35 to 35 (1 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 11 to 193 (183 residues), 143.6 bits, see alignment E=3.3e-46

Best Hits

Swiss-Prot: 65% identical to SATP_ECO57: Succinate-acetate/proton symporter SatP (satP) from Escherichia coli O157:H7

KEGG orthology group: K07034, (no description) (inferred from 100% identity to mmp:MMP0348)

MetaCyc: 65% identical to acetate/succinate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN0-571

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>MMJJ_RS03515 GPR1/FUN34/YaaH family transporter (Methanococcus maripaludis JJ)
MQEKYTTIFDTSANPAPLGLMGFGMTTVLLNLHNIGLFELSSMILAMGICYGGLAQVIVG
IMEWKKGNTFGTLAFTSYGLFWLSLVVILTLPKLGLGNAPSPLEMAFYLGLWGLFTLGMF
FGTFKTNRALQFVFGTLTILFLLLATGDITGNLTVTRVAGLVGIICGSSAIYTGFAEVLN
ETYQKTVLPIFPVTKKP