Protein Info for MMJJ_RS03245 in Methanococcus maripaludis JJ

Annotation: UMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 3 to 203 (201 residues), 113.7 bits, E=5.9e-37
• TIGR02076: putative uridylate kinase
  • amino acids 3 to 223 (221 residues), 274 bits, E=4.7e-86

Best Hits

Swiss-Prot: 98% identical to PYRH_METMP: Uridylate kinase (pyrH) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09903, uridylate kinase [EC: 2.7.4.22] (inferred from 98% identity to mmp:MMP0385)

Predicted SEED Role

"Uridine monophosphate kinase (EC 2.7.4.22)" (EC 2.7.4.22)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.22

Protein Sequence (225 amino acids)

>MMJJ_RS03245 UMP kinase (Methanococcus maripaludis JJ)
MDVVFALGGSVLMPKEGASTENIQNYAKAFKKLKEMGHRVSVVVGGGNTARQYISVAREF
ANESFCDEIGILATRMNSMLLISALGKDAVKQVPENFKDAEIILNMDKILVMGGTHPAHT
TDAVSATLAEFIDADLLVIATNVDGVYNKDPRCNKDAVKLDKINTKELLEITGSSSMSAG
SSGVVDPLASKIIDRAKLKTIVVKGIPEEIISSVSGNHNGTTITP