Protein Info for MMJJ_RS03205 in Methanococcus maripaludis JJ

Annotation: metallophosphoesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF12850: Metallophos_2" amino acids 1 to 158 (158 residues), 131.8 bits, see alignment E=2.2e-42 PF00149: Metallophos" amino acids 1 to 123 (123 residues), 48.1 bits, see alignment E=2e-16 TIGR00040: phosphodiesterase, MJ0936 family" amino acids 1 to 162 (162 residues), 157.6 bits, see alignment E=1.4e-50

Best Hits

Swiss-Prot: 68% identical to P936_METJA: Phosphodiesterase MJ0936 (MJ0936) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07095, (no description) (inferred from 99% identity to mmp:MMP0393)

Predicted SEED Role

"Phosphodiesterase MJ0936 (EC 3.1.4.-)" (EC 3.1.4.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>MMJJ_RS03205 metallophosphoesterase (Methanococcus maripaludis JJ)
MKIGIMSDTHDYLPNIRKAIAVFNDEKVDMVVHCGDFVSLFVIKEFENLNSKIVGVFGNN
DGEKTLLKEWLKEIDPDNELENYVSFETDGHKFFVLHGTHAPILEAVIQSKEYDVVIHGH
THERQFEEIDGVLVINPGECCGYLTGKPTVAILNTKDKEYQEIDLDEVSEI