Protein Info for MMJJ_RS03190 in Methanococcus maripaludis JJ

Annotation: phosphopyruvate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03952: Enolase_N
  • amino acids 11 to 140 (130 residues), 187.9 bits, E=7.8e-60
• TIGR01060: phosphopyruvate hydratase
  • amino acids 11 to 426 (416 residues), 625.3 bits, E=2.2e-192
• PF00113: Enolase_C
  • amino acids 146 to 427 (282 residues), 418.5 bits, E=1.5e-129

Best Hits

Swiss-Prot: 98% identical to ENO_METMP: Enolase (eno) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 98% identity to mmp:MMP0396)

MetaCyc: 65% identical to enolase subunit (Pyrococcus furiosus)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• chorismate biosynthesis II (archaea) (12/12 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• glycolysis V (Pyrococcus) (10/10 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• chorismate biosynthesis I (6/7 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• gluconeogenesis I (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• gluconeogenesis III (9/12 steps found)
• glycolysis III (from glucose) (8/11 steps found)
• gallate biosynthesis (2/3 steps found)
• homolactic fermentation (8/12 steps found)
• Bifidobacterium shunt (10/15 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• quinate degradation I (1/3 steps found)
• quinate degradation II (1/3 steps found)
• superpathway of anaerobic sucrose degradation (12/19 steps found)
• superpathway of glucose and xylose degradation (10/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
• Entner-Doudoroff pathway I (4/9 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• superpathway of hexitol degradation (bacteria) (10/18 steps found)
• glycerol degradation to butanol (8/16 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• formaldehyde assimilation I (serine pathway) (5/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (9/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (13/26 steps found)
• ethene biosynthesis V (engineered) (12/25 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
• superpathway of N-acetylneuraminate degradation (9/22 steps found)
• heterolactic fermentation (6/18 steps found)
• superpathway of chorismate metabolism (25/59 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (2/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (3/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.11

Protein Sequence (430 amino acids)

>MMJJ_RS03190 phosphopyruvate hydratase (Methanococcus maripaludis JJ)
MLRNMDDSFDIYEIKARQVLDSRGNPTVEAEVLTAGGGYGHTIVPSGASTGTFEAVELRD
KSEKYGGKSVLTAVSNVNDIIAQELIGEDARNQRLIDQIMITLDGTENKGNLGANAILAV
SLAVAKAAADTASLPLYKYIGGSNAYVMPAPMMNVLNGGQHAGNALDFQEFMIMPVGADS
FAEAVRMCSETYQSLKKVVAEKYGKDAVNVGDEGGFAPPVKTIDEALAVLLDGVKKAGYE
DEIVFTIDSAASEFYDEKSRSYMIAGEKVSTDKLIDIYKEMVAQYPIVSIEDPLFEEDFE
GFKTATKELKGIQIVGDDLFVTNTKRLKKGIEMGAANSLLLKVNQIGTLSESIDAANMAF
RNGYSLVVSHRSGESEDSTIADLAVALNAGQIKTGAPARGERTAKYNQLMRIEEELQISK
YAGKDFKIPF