Protein Info for MMJJ_RS03160 in Methanococcus maripaludis JJ

Annotation: winged helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 217 to 237 (21 residues), see Phobius details PF12802: MarR_2" amino acids 387 to 435 (49 residues), 33.8 bits, see alignment 6e-12 PF13412: HTH_24" amino acids 391 to 433 (43 residues), 31.4 bits, see alignment 2.3e-11 PF01047: MarR" amino acids 392 to 435 (44 residues), 30.7 bits, see alignment 4.9e-11 PF09339: HTH_IclR" amino acids 393 to 434 (42 residues), 29.4 bits, see alignment 1.1e-10

Best Hits

KEGG orthology group: None (inferred from 96% identity to mmp:MMP0402)

Predicted SEED Role

"Chromosome partition protein smc" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>MMJJ_RS03160 winged helix-turn-helix transcriptional regulator (Methanococcus maripaludis JJ)
MSKPILNNYKLYLLVALMFCSISAVDSYRFDDYSVIYSIDQNDNFYEEINLKIYNNNSDD
LYEISYTIPQETSNLTFNSSKEIDSYSITTDDAGATEVSVKLTEPIGPWQTGDLLVSFTG
EVSDIGGKKQVYIIVPAFDSNFKLSVQLPEGAAIVSPVKDVLSISPRDYTVGTNGKSIFV
EWEKELTSEEKYFEVTINYVLTGVITPSTTGENNEDLYRAVSIVLAVLVVALIFFIYRNY
NKVKMINELQNEINGLNKGLEISHLNLQNKNKELQRLEELNEHVLKELDLSKNKLKDYEL
KINELNEEILQCRDQVGNHTKLKEELNSKDAVIKSLNDYKKLSEELKLKINELNGLIGEK
ERYIIELKEKIGDYESHKSETLMNILTDDEKQLIELIREHGSISQKEIVDVTGLTKPKVS
RMISDLEQRGMVRKVKIGRINKIALSEDLDGSI