Protein Info for MMJJ_RS03120 in Methanococcus maripaludis JJ

Annotation: ribose-phosphate diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF13793: Pribosyltran_N" amino acids 1 to 112 (112 residues), 104.6 bits, see alignment E=4.4e-34 TIGR01251: ribose-phosphate diphosphokinase" amino acids 1 to 284 (284 residues), 327.5 bits, see alignment E=3.4e-102 PF00156: Pribosyltran" amino acids 155 to 242 (88 residues), 61.1 bits, see alignment E=1.2e-20 PF14572: Pribosyl_synth" amino acids 202 to 279 (78 residues), 37 bits, see alignment E=5.4e-13

Best Hits

Swiss-Prot: 69% identical to KPRS_METJA: Ribose-phosphate pyrophosphokinase (prs) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 99% identity to mmp:MMP0410)

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>MMJJ_RS03120 ribose-phosphate diphosphokinase (Methanococcus maripaludis JJ)
MIIIPGLNSQNLAKEVAKLTNSELARVESKQFPDGEIYVRVHNELKGKDAVIIQTQNTQN
DSIVEAILMCEALREEGVKSITLVAPYLAYARQDKKFNAGEPISIKALAKVYSSICDRII
TINPHETHIEEFFDIPFIYGDAIPKLAEHAGVKLVNPLVLSPDKGAVALAKRAAEELNCE
CDYLEKTRISPTEIKIAPKNLDVSGKDVLIVDDIISTGGTMATAISMLIEQGARTVIAAC
VHPVLIGDALNKLHLGGASEIVGTNTYPSEVSKVCVSTIIADILNGE