Protein Info for MMJJ_RS03095 in Methanococcus maripaludis JJ

Annotation: bifunctional N(6)-L-threonylcarbamoyladenine synthase/serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 TIGR03722: universal archaeal protein Kae1" amino acids 9 to 329 (321 residues), 485.8 bits, see alignment E=8.6e-150 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 11 to 296 (286 residues), 331.2 bits, see alignment E=9.4e-103 PF00814: TsaD" amino acids 35 to 297 (263 residues), 282.5 bits, see alignment E=8.2e-88 PF22521: HypF_C_2" amino acids 179 to 292 (114 residues), 39.8 bits, see alignment E=9.5e-14 TIGR03724: Kae1-associated kinase Bud32" amino acids 352 to 547 (196 residues), 236 bits, see alignment E=3.9e-74 PF01163: RIO1" amino acids 392 to 483 (92 residues), 26.1 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 96% identical to KAE1B_METMP: Probable bifunctional tRNA threonylcarbamoyladenosine biosynthesis protein (MMP0415) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] K07174, Mn2+-dependent serine/threonine protein kinase [EC: 2.7.1.-] (inferred from 96% identity to mmp:MMP0415)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA / p53-regulating protein kinase (human PRPK/yeast YGR262c)" in subsystem YgjD and YeaZ

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>MMJJ_RS03095 bifunctional N(6)-L-threonylcarbamoyladenine synthase/serine/threonine protein kinase (Methanococcus maripaludis JJ)
MDNSKDLICIGFEGTAEKSGVGIITSKGEVLFNKTIIYTPPVQGIHPREAADHHAETFVK
LLKEALNEVPLEKIDLVSFSLGPGLGPSLRVTATTARALSLSINKPIIGVNHCIGHVEIG
KLTTEAVDPLTLYVSGGNTQVLAYTGKKYRVIGETLDIAIGNCLDQFARHCNLPHPGGVY
VEKYAKDGNKFIKLPYTVKGMDLSLSGLLTSAMKKYDSKERIEDVCYSLQETSFSMLTEI
TERALAHTNKAEVMLVGGVAANNRLKEMLNIMCEEQNVDFYVPEKQFCGDNGAMIAWLGI
LQYLNGKRMDLNDTKPISNYRSDMVEVNWIHDENKTLENGNIKSRKIPKHLIGKGAEADI
SKGRYLEFESITKERVKKGYRILKLDDLIRTRRTVKEARFLAAVKEFGIYAPSIYDIDKE
NKKITMSYIHGKIAKDEIEDGNIEFCKSLGETIGKMHGSGIVHNDLTTSNFIISKNPYII
DFGLGKYSDLIEDKAIDLIVLKKSIMSIHYDKFDPVWNKIIEGYKTYELAESVLECIKEV
EKRVRYL