Protein Info for MMJJ_RS03090 in Methanococcus maripaludis JJ

Annotation: ECF transporter S component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details PF12822: ECF_trnsprt" amino acids 18 to 177 (160 residues), 34.3 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: None (inferred from 97% identity to mmp:MMP0416)

Predicted SEED Role

"Substrate-specific component STY3230 of queuosine-regulated ECF transporter" in subsystem ECF class transporters or Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>MMJJ_RS03090 ECF transporter S component (Methanococcus maripaludis JJ)
MKRLNHSRCRINDCAYVVAISLGLNILGSQAVTYLQLPAFLDSTGTILAAVLLGPLFGSL
VGLLTNLIEGFFIYSGLYYFAIVNILIGFVTGIIFKKYPFNVKYVVITTIILALIGTIVG
NIIAYYLFGGITGSPIDDVTIYLAGSGMSVYNAVFVSGFIINLFDKIISFVLVFLIIGFF
QKYVDKCYLNIKFDDKTK