Protein Info for MMJJ_RS03085 in Methanococcus maripaludis JJ

Annotation: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00977: His_biosynth" amino acids 3 to 228 (226 residues), 272.5 bits, see alignment E=5.6e-85 TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase" amino acids 3 to 233 (231 residues), 284.5 bits, see alignment E=3.3e-89 PF01207: Dus" amino acids 60 to 122 (63 residues), 21.9 bits, see alignment E=1.7e-08

Best Hits

Swiss-Prot: 98% identical to HIS4_METMP: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 98% identity to mmp:MMP0417)

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.16

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>MMJJ_RS03085 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase (Methanococcus maripaludis JJ)
MLVIPAVDMKNKKCVQLIQGNPDKKHVELDNPPEIAKKWVNEGAEMLHLVDLDGALDGKR
VNDEFIEEIIKTSGVPVQIGGGIRSIEDAEYLVEKGAKKVIIGTIAVETPEIIKELSKRI
GSEKIMVSLDAKDGKVVIKGWKEKTKYTPVKIGKILEEMGAGSILFTNVDSEGLLNGINI
EPTKELVENLKIPIVASGGVTTIDDLLKLKEIGVYGVVVGSAIYKNLINLKEAIEAVK