Protein Info for MMJJ_RS02945 in Methanococcus maripaludis JJ

Annotation: dihydroorotate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF01180: DHO_dh" amino acids 1 to 288 (288 residues), 299.4 bits, see alignment E=3.9e-93 TIGR01037: dihydroorotate dehydrogenase family protein" amino acids 2 to 302 (301 residues), 395.6 bits, see alignment E=6.5e-123 PF01207: Dus" amino acids 101 to 281 (181 residues), 40.7 bits, see alignment E=2.6e-14

Best Hits

Swiss-Prot: 64% identical to PYRDB_METJA: Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit (pyrD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 97% identity to mmp:MMP0439)

Predicted SEED Role

"Dihydroorotate dehydrogenase, catalytic subunit (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.3.1

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>MMJJ_RS02945 dihydroorotate dehydrogenase (Methanococcus maripaludis JJ)
MLKTKLWDIEFKNPVFLAAGVMGETGSALKRMAKNGAGAVCTKSVGIEKKPGHNNPTMVE
VEGGFLNAMGLPNPGADEYAGEIERIKDEMKRMNVKIIGSIYGKNDSEFQKAAEVIATHV
DVLELNISCPHAGGGYGSSIGQDPCLCKNVVSAVKDVSDIPVIAKLTPNVTDIKEIASAV
VNAGADGIVAINTLGPGMVIDIESGVPILGNKVGGMSGKAIKPIAVKNVYDICSAVDVPV
IGVGGITTGADAIEFMMAGASAVQVGTGVYYRGYDIFQKINNEIEEYLLKKDLKMSDIIG
IAQK