Protein Info for MMJJ_RS02325 in Methanococcus maripaludis JJ

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 17 to 42 (26 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF07670: Gate" amino acids 21 to 119 (99 residues), 36.1 bits, see alignment E=3.9e-13

Best Hits

Swiss-Prot: 58% identical to Y871_METJA: Uncharacterized protein MJ0871 (MJ0871) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 75% identity to mmq:MmarC5_0605)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>MMJJ_RS02325 hypothetical protein (Methanococcus maripaludis JJ)
MNIFDFSILGNSLLSAALYTIKLSSVVLLTMFIMNCLINTGIMKKVSNFLYPFTKHLKMN
QLSLYSILSCFFSPTVGYSILAEGYNDKKVNEKELIGSSLANSFPSIFSHTFTFFIPIAI
PLLGMTGVIYILIRSGVAMVKTIIGLCYLALVSKNTVEYEPKNEEQKNIKKSMKKSFEST
LRVSKRILPIMFVTMFIVIYFSNLGVFEVIKLIINPVTGYLNLDPSVGILILTDLINVQA
AMVMGSGLLEKGVLSSKDVIIGLIFANVISLSTRYAKHSLPLHVSLFGPKLGTKIVMINA
SITFAIDILIIGAFLLLG