Protein Info for MMJJ_RS02210 in Methanococcus maripaludis JJ

Annotation: phosphoserine phosphatase SerB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR00338: phosphoserine phosphatase SerB" amino acids 6 to 210 (205 residues), 273.5 bits, see alignment E=1.2e-85 PF00702: Hydrolase" amino acids 8 to 181 (174 residues), 86.9 bits, see alignment E=6.2e-28 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 9 to 180 (172 residues), 114 bits, see alignment E=7.9e-37 PF13419: HAD_2" amino acids 10 to 185 (176 residues), 31.1 bits, see alignment E=6e-11 PF12710: HAD" amino acids 10 to 178 (169 residues), 78.8 bits, see alignment E=1.8e-25 PF08282: Hydrolase_3" amino acids 143 to 203 (61 residues), 38.6 bits, see alignment E=2.7e-13

Best Hits

Swiss-Prot: 63% identical to SERB_METJA: Phosphoserine phosphatase (MJ1594) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 98% identity to mmp:MMP0541)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>MMJJ_RS02210 phosphoserine phosphatase SerB (Methanococcus maripaludis JJ)
MTDNLVKKLILFDLDSTLADCEVIDEIAKFAGVESEIKKITNEAMKGNINFEESLRRRVK
LLKGIPVEKLYKFAEKIPVMNGAPELILELKKQGYITAVVSGGFDFGAEHVKKVLGLDYS
YANTLLSENGILTGEVIGPVMSKTAKGDILEKIAANENISLKNTVVVGDGANDISMFEKA
GFKIAFCAKEILRSKADICIDKKDLKEILNHIN