Protein Info for MMJJ_RS02200 in Methanococcus maripaludis JJ

Annotation: chorismate pyruvate-lyase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF01947: Rv2949c-like" amino acids 30 to 167 (138 residues), 67 bits, see alignment E=9.2e-23

Best Hits

Swiss-Prot: 61% identical to Y807_METJA: Putative lyase MJ0807 (MJ0807) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 97% identity to mmp:MMP0543)

MetaCyc: 61% identical to chorismate lyase (Methanocaldococcus jannaschii)
Chorismate lyase. [EC: 4.1.3.40]

Predicted SEED Role

"beta-ribofuranosylaminobenzene 5'-phosphate synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>MMJJ_RS02200 chorismate pyruvate-lyase family protein (Methanococcus maripaludis JJ)
MDDRYLKPHIVIGDLSKIHELNNEEKILLGTDGSITNLLEILFGDEVVVETLYQEIIDNV
NYRAVLLGVNGIPLIYATSETPLNRIDEIHIREKIKKDLLSADIPIGKILKIHNLETRRE
IVEIAVKEVPDVVKNKLNPKRIKIPQRTYNIIHKNKVLMTITEMFNLDDHL