Protein Info for MMJJ_RS02200 in Methanococcus maripaludis JJ

Annotation: chorismate pyruvate-lyase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01947: Rv2949c-like
  • amino acids 30 to 167 (138 residues), 67 bits, E=9.2e-23

Best Hits

Swiss-Prot: 61% identical to Y807_METJA: Putative lyase MJ0807 (MJ0807) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 97% identity to mmp:MMP0543)

MetaCyc: 61% identical to chorismate lyase (Methanocaldococcus jannaschii)
Chorismate lyase. [EC: 4.1.3.40]

Predicted SEED Role

"beta-ribofuranosylaminobenzene 5'-phosphate synthase"

MetaCyc Pathways

• 4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
• polybrominated phenols biosynthesis (1/4 steps found)
• spongiadioxin C biosynthesis (1/7 steps found)
• tetrahydromethanopterin biosynthesis (6/14 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
• p-HBAD biosynthesis (1/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (1/9 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (3/12 steps found)
• superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
• phenolphthiocerol biosynthesis (1/23 steps found)
• superpathway of chorismate metabolism (25/59 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Protein Sequence (171 amino acids)

>MMJJ_RS02200 chorismate pyruvate-lyase family protein (Methanococcus maripaludis JJ)
MDDRYLKPHIVIGDLSKIHELNNEEKILLGTDGSITNLLEILFGDEVVVETLYQEIIDNV
NYRAVLLGVNGIPLIYATSETPLNRIDEIHIREKIKKDLLSADIPIGKILKIHNLETRRE
IVEIAVKEVPDVVKNKLNPKRIKIPQRTYNIIHKNKVLMTITEMFNLDDHL