Protein Info for MMJJ_RS02120 in Methanococcus maripaludis JJ

Annotation: DJ-1/PfpI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01382: intracellular protease, PfpI family
  • amino acids 4 to 169 (166 residues), 140.1 bits, E=2.6e-45
• PF01965: DJ-1_PfpI
  • amino acids 4 to 167 (164 residues), 143.8 bits, E=2.2e-46

Best Hits

Swiss-Prot: 58% identical to Y967_METJA: Uncharacterized protein MJ0967 (MJ0967) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 94% identity to mmp:MMP0559)

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.-

Protein Sequence (171 amino acids)

>MMJJ_RS02120 DJ-1/PfpI family protein (Methanococcus maripaludis JJ)
MAIVMVIAPEKFRDEELFEPLQVFQSKNIATQVVSTTTGQHKGVLGRVMTTTKTIGEVNP
DDFDAIVIVGGGGSRDYLWNNEKLLELLKEFNAMGKITAAICISPAVLAQAGLLAGKKAT
VFPDDESIEVLQQNGAIYLDEAVILDGNIITGRNPDAAKEFGLKIAEALGK