Protein Info for MMJJ_RS02080 in Methanococcus maripaludis JJ
Annotation: AMP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to YNGI_BACSU: Putative acyl-CoA synthetase YngI (yngI) from Bacillus subtilis (strain 168)
KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 98% identity to mmp:MMP0566)Predicted SEED Role
"Acetoacetyl-CoA synthetase (EC 6.2.1.16) / Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Polyhydroxybutyrate metabolism or Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.16, EC 6.2.1.3)
MetaCyc Pathways
- long-chain fatty acid activation (1/1 steps found)
- γ-linolenate biosynthesis II (animals) (1/2 steps found)
- linoleate biosynthesis II (animals) (1/2 steps found)
- alkane biosynthesis II (1/3 steps found)
- oleate biosynthesis I (plants) (1/3 steps found)
- long chain fatty acid ester synthesis (engineered) (1/4 steps found)
- phosphatidylcholine acyl editing (1/4 steps found)
- phytol degradation (1/4 steps found)
- wax esters biosynthesis II (1/4 steps found)
- 3-methyl-branched fatty acid α-oxidation (2/6 steps found)
- octane oxidation (1/5 steps found)
- 6-gingerol analog biosynthesis (engineered) (1/6 steps found)
- fatty acid salvage (1/6 steps found)
- stearate biosynthesis I (animals) (1/6 steps found)
- stearate biosynthesis II (bacteria and plants) (1/6 steps found)
- stearate biosynthesis IV (1/6 steps found)
- 2-deoxy-D-ribose degradation II (2/8 steps found)
- arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
- capsaicin biosynthesis (1/7 steps found)
- ceramide degradation by α-oxidation (1/7 steps found)
- icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
- icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
- sphingosine and sphingosine-1-phosphate metabolism (2/10 steps found)
- sporopollenin precursors biosynthesis (4/18 steps found)
- ceramide and sphingolipid recycling and degradation (yeast) (2/16 steps found)
- cutin biosynthesis (1/16 steps found)
- suberin monomers biosynthesis (2/20 steps found)
- palmitate biosynthesis III (1/29 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (2/31 steps found)
- oleate β-oxidation (3/35 steps found)
- superpathway of fatty acid biosynthesis II (plant) (4/43 steps found)
- superpathway of fatty acids biosynthesis (E. coli) (2/53 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis II
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Butanoate metabolism
- Caprolactam degradation
- Ethylbenzene degradation
- Fatty acid metabolism
- Geraniol degradation
- Limonene and pinene degradation
- Propanoate metabolism
- Tyrosine metabolism
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 6.2.1.-
Use Curated BLAST to search for 6.2.1.- or 6.2.1.16 or 6.2.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (549 amino acids)
>MMJJ_RS02080 AMP-binding protein (Methanococcus maripaludis JJ) MLFTNNTIGEFFEKQAQKDPDREFLVYPDRNLRFTYKEFDERTDLLAKGLLEIGIKKGDH IGIWARNVPDWLTFMFATAKIGVVLVTVNTAYKSHELAYVMKQSDMKALAIIDSFRDVNY LEILYELVPELKTSQRGKLNSEEFPYLKNVIYVGQEKHRGMYNTNELMLLGKYVSDEKLI EAKKGLDSDDVINMQYTSGTTGFPKGVMLTHKNILNNGYYIGEKQKFTEEERLCLPVPLF HCFGIVLGVLALLTHGGTLVMLEIFDPLLVLAAIQKEKCTAVYGVPTMFIAEFSHPMFEM FDLSSLRTGIMAGSTCPIEAMKKVMSDMYMHEITISYGLTEASPVFTMTSVDDPFEKRVE SVGKAMPHCEVKIIDPETGKTLAPGNVGEICCRGYNVMKGYYKMPEKTAEVIEKDGWLHS GDLAVEDEDGYYKIVGRIKDMIIRGGENIYPREIEEFLYTLPGINDAQVVGIPDEKYGEI VGAFVIPKEGYEIKEEDVRDFALEKIARYKVPKHVFVVEEFPMTASGKIQKFKLTELAVE LLKKEKEDL