Protein Info for MMJJ_RS01935 in Methanococcus maripaludis JJ

Annotation: O-phosphoseryl-tRNA(Sec) selenium transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 TIGR03531: O-phosphoseryl-tRNA(Sec) selenium transferase" amino acids 9 to 435 (427 residues), 595.3 bits, see alignment E=3.2e-183 PF05889: SepSecS" amino acids 58 to 435 (378 residues), 489.4 bits, see alignment E=6.8e-151 PF01212: Beta_elim_lyase" amino acids 192 to 313 (122 residues), 32.4 bits, see alignment E=6.4e-12

Best Hits

Swiss-Prot: 99% identical to SPCS_METMP: O-phosphoseryl-tRNA(Sec) selenium transferase (spcS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03341, O-phospho-L-seryl-tRNASec:L-selenocysteinyl-tRNA synthase [EC: 2.9.1.2] (inferred from 99% identity to mmp:MMP0595)

MetaCyc: 99% identical to O-phosphoseryl-tRNA:selenocysteinyl-tRNA synthase subunit (Methanococcus maripaludis)

Predicted SEED Role

"O-phosphoseryl-tRNA(Sec) selenium transferase" in subsystem Selenocysteine metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>MMJJ_RS01935 O-phosphoseryl-tRNA(Sec) selenium transferase (Methanococcus maripaludis JJ)
MLDFNIEGLIPKNMEKRGELVLNEYLKEIEDVFNHRKIPENGIDDEKIKLFLKFLSMMDT
DKDPKSVRIGEREARTYSKIHEELSSGFCHGIGRSGNLVDPQPKASGASIMYALTNKILE
SFFKQLGLNVHAIATPISTGMSISLCLSAARKKYGSNIVIYPYASHKSPIKAVSFVGMNM
RLVETVLDCDRVYVPVEDIENAIKKEIELGNRPCVLSTLTFFPPRNSDDIVEIAKICENY
DIPHIINGAYAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGGLVYSTDAEFIKEI
SLSYPGRASATPVVNTLVSLLSIGSKNYLELVKNQKNSKKLLDELLNDLSKKTGGKFLDV
ESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDYIVMNAAIGVR
TEDIVNSVSKLEKILL