Protein Info for MMJJ_RS01915 in Methanococcus maripaludis JJ

Annotation: precorrin-6A reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to CBIJ_METMI: Cobalt-precorrin-6A reductase (cbiJ) from Methanococcus maripaludis

KEGG orthology group: K05895, precorrin-6X reductase [EC: 1.3.1.54] (inferred from 93% identity to mmp:MMP0599)

Predicted SEED Role

"Cobalt-precorrin-6x reductase (EC 1.3.1.54)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 1.3.1.54)

MetaCyc Pathways

cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (10/13 steps found)
adenosylcobalamin biosynthesis II (aerobic) (24/33 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>MMJJ_RS01915 precorrin-6A reductase (Methanococcus maripaludis JJ)
MNIWIRGGTSDANNISKEIKRNFKDSFLILTTTTDFGGKIAENFADLVISEKMTYDNLKK
TLLDKKIDVFIDATHPFATHASETGIKISKELNIPYIRYERPSEKFKNAFYVENYEEAAK
LALKISKKNIFYMSGIKNLKNVSEIIPIEKLIVRILPTSVPEALKILPSKNIVAMQGVFS
ENLNKELIIDYNCDVIITKDSGKSGGLYEKVSGATLAGAKPIIIKRPEINYPLKFEKIVE
IVNYLKNV