Protein Info for MMJJ_RS01875 in Methanococcus maripaludis JJ

Annotation: global nitrogen regulator NrpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 PF08461: WHD_RNase_R" amino acids 7 to 72 (66 residues), 108.2 bits, see alignment E=1.6e-35 PF01995: NRD1_2" amino acids 81 to 298 (218 residues), 206.3 bits, see alignment E=4.4e-65 amino acids 317 to 531 (215 residues), 227.1 bits, see alignment E=1.9e-71

Best Hits

Swiss-Prot: 100% identical to NRPR_METMP: Global nitrogen regulator NrpR (nrpR) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09720, hypothetical protein (inferred from 100% identity to mmp:MMP0607)

Predicted SEED Role

"Transcriptional repressor of nif and glnA operons" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>MMJJ_RS01875 global nitrogen regulator NrpR (Methanococcus maripaludis JJ)
MDSNIDVEILSILSEASAPVGAKIIADSLKDRGYDIGERAVRYHLKVLDENSLTKKLGYS
GREITEKGIEELEKANISFRIGSVFSQVIEKLYLSDFPSKVLINTAKFEGEYKTIKEMVL
RSFEAGYSVGDYLNIKKKGNTVSVETLCSITFDNFLLKNGIIPTPEYGGIVKFEDYEPVN
FEGVIDFKSSSIDPLVAFIMQGKTDVIGVIENGEGLVPANFRVIPKSSEKQFETILKKDM
LNSVLAYGTENVLGMNLNPEQIGVVLVGGLTPLCIPHESGYTADISAATQLKDISSMEKK
TKGFLEAKKKKGKFKVTPVLSKMLSKMQTINYDIEDKKGNVVVNTAKIPIEYKEEAINAL
KDSYENKLAISDRLKVECDDKFLNAYTICSLTVDGVFLKNKIPVIPYYGGILEVKADKKR
FIEAIDYEGTSLDPHEVFFNKADGKNYILAGIRKVPMSASEKLIELNEKLGWNSIIEIGR
PNNDICGVRVEKCMFGITTIGGTNPFANIRKNNIPVEMKTLHKSIDYSELTHYDDI