Protein Info for MMJJ_RS01860 in Methanococcus maripaludis JJ

Annotation: tRNA guanosine(15) transglycosylase TgtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 TIGR00432: tRNA-guanine(15) transglycosylase" amino acids 2 to 647 (646 residues), 903.3 bits, see alignment E=8.3e-276 TIGR00449: tRNA-guanine family transglycosylase" amino acids 2 to 342 (341 residues), 316.9 bits, see alignment E=1.7e-98 PF01702: TGT" amino acids 11 to 342 (332 residues), 309.4 bits, see alignment E=5.2e-96 PF14810: TGT_C2" amino acids 502 to 572 (71 residues), 68.7 bits, see alignment E=6.3e-23 PF01472: PUA" amino acids 575 to 645 (71 residues), 50.6 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 98% identical to ATGT_METMP: tRNA-guanine(15) transglycosylase (tgtA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] K07398, conserved protein with predicted RNA binding PUA domain (inferred from 98% identity to mmp:MMP0610)

MetaCyc: 69% identical to 7-cyano-7-deazaguanine tRNA-ribosyltransferase monomer (Methanocaldococcus jannaschii)
RXN-12144 [EC: 2.4.2.48]

Predicted SEED Role

"archaeosine tRNA-ribosyltransferase (EC 2.4.2.-) type 1 / archaeosine tRNA-ribosyltransferase (EC 2.4.2.-) PUA domain" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 2.4.2.29 or 2.4.2.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (649 amino acids)

>MMJJ_RS01860 tRNA guanosine(15) transglycosylase TgtA (Methanococcus maripaludis JJ)
MFEIKARDAMGRLGVITINGKKIETPTIMPVIHPNPKKQTVSMDLINKMADVVITNSYIT
YTTPELREIAETKGIHELIDFKNVVVTDSGSFQLSVYGDVNVGPMEIIDFQEKIGVDVGT
ILDIPTAPDVSREKAESDLIETFKRAEDSIKRRSEMGYKLALNGTIQGSKYLDLRQKSAE
VMGKMDFDIYPIGAVVPLMEDYRYREVAEVILNSKMHLPTNKPVHLFGCGHPMLFALSVA
LGCDLFDSAAYALYAKNGRYLTADGTLHLKDMKDLKSFPCTCKVCSEYTPKQLYNLNEKE
KTRLLAEHNLYVTFEEIDRIKNAIKEGNLWELVEERCRSHPKLLNGLRVISKYMDFIEKH
DPVSKKSGFFYTGYESMNRPEIYRHKQRLERIQYDKIYVTSVSEHTSKPYHENLDNVPCD
VDVLIKDSVFGLVPLNIDTMYPLAQNEVPDLYDFEKKYNNEFISEFKEKHAEKILDISTY
NYYINHYGKKKECDKVNPDIFRIGKMLEYQYGAKILDDELMGKVKSRRSKNTGRIRNLLL
EKEVLFTLRANDNFLIPAKSGAELLHEKLEFPKYRIIIDSSVEEFARAGKSVYSKFVKDC
DPELRPFEEVLIVNSDDELLAYGTTILNGRELMEFDYGVAATLRGGLKK