Protein Info for MMJJ_RS01840 in Methanococcus maripaludis JJ

Annotation: flavodoxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF03358: FMN_red" amino acids 1 to 159 (159 residues), 110.5 bits, see alignment E=5.9e-36 PF02525: Flavodoxin_2" amino acids 1 to 117 (117 residues), 35.8 bits, see alignment E=6.9e-13

Best Hits

Swiss-Prot: 33% identical to ISF1_METJA: Iron-sulfur flavoprotein MJ0731 (MJ0731) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 98% identity to mmp:MMP0614)

Predicted SEED Role

"Iron-sulfur flavoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>MMJJ_RS01840 flavodoxin family protein (Methanococcus maripaludis JJ)
MKVVAFNGSPRRDGNTSILIDKVLNELKKEGITTEHIHIAGGKLRGCTACYKCFETLNNK
CIIECDIINNCIEKMIEADGIILGSPTYFTDVTAEMKALIDRAGFVAKANDDILKRKVGA
AVVSVRRAGGIHVFDTINHFFSINQMIGVGSDYWNLGMGLDIGDVQKDAEGLRTMELLGQ
NMAWILKKINE