Protein Info for MMJJ_RS01675 in Methanococcus maripaludis JJ

Annotation: malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00056: Ldh_1_N
  • amino acids 2 to 145 (144 residues), 100.9 bits, E=6.6e-33
• PF02866: Ldh_1_C
  • amino acids 148 to 303 (156 residues), 106.7 bits, E=1.4e-34

Best Hits

Swiss-Prot: 98% identical to MDH_METMP: Malate dehydrogenase (mdh) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 98% identity to mmp:MMP0645)

MetaCyc: 57% identical to L-2-hydroxycarboxylate dehydrogenase [NAD(P)+] (Methanocaldococcus jannaschii)
RXN-15632 [EC: 1.1.1.375]; 1.1.1.375 [EC: 1.1.1.375]; RXN-10813 [EC: 1.1.1.375, 1.1.1.299]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• incomplete reductive TCA cycle (6/7 steps found)
• gluconeogenesis I (10/13 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• gluconeogenesis III (9/12 steps found)
• TCA cycle VIII (Chlamydia) (4/6 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• reductive TCA cycle I (6/11 steps found)
• TCA cycle V (2-oxoglutarate synthase) (4/9 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• TCA cycle III (animals) (4/10 steps found)
• glyoxylate cycle (1/6 steps found)
• TCA cycle II (plants and fungi) (3/9 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (4/11 steps found)
• TCA cycle I (prokaryotic) (3/10 steps found)
• formaldehyde assimilation I (serine pathway) (5/13 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (2/9 steps found)
• superpathway of glyoxylate bypass and TCA (3/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (13/26 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (3/13 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (2/14 steps found)
• mixed acid fermentation (3/16 steps found)
• methylaspartate cycle (3/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.299 or 1.1.1.37 or 1.1.1.375

Protein Sequence (314 amino acids)

>MMJJ_RS01675 malate dehydrogenase (Methanococcus maripaludis JJ)
MDVSIIGASGKIGSVLSLLLAKESYIKNINLIARNSSINKLKGLKMDLYDAMAAAGQDTN
IDICCDDDLSCTANSDITIITAGMARTGEMSRIDLMKGNAKIVKNYVKNIANFGDTKIFM
ISNPVDLMTYKALIESGYEKNQVFGLGTHLDSMRFKVAVAKHFEVHLDDVRTRIVGEHGD
SMVPVISATAVGGIPIKRLPKYEDFPYEKILERIKGYGQEIITLKNGSEYGPASAIVNIV
RCIAHDEKRLLTLSTYIEDEIEGIEGGCCIGVPVKVGKNGIEEVIHIKMEDNEIEGFKKS
FELVKGYCRQIESI