Protein Info for MMJJ_RS01590 in Methanococcus maripaludis JJ

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR01090: adenine phosphoribosyltransferase" amino acids 3 to 170 (168 residues), 217.7 bits, see alignment E=5.3e-69 PF00156: Pribosyltran" amino acids 26 to 139 (114 residues), 50.8 bits, see alignment E=5.9e-18

Best Hits

Swiss-Prot: 99% identical to APT_METMP: Adenine phosphoribosyltransferase (apt2) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 99% identity to mmp:MMP0660)

MetaCyc: 49% identical to adenine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.7

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>MMJJ_RS01590 adenine phosphoribosyltransferase (Methanococcus maripaludis JJ)
MDLRKKIRIVENFPIEGISFKDVTPILKDPKAMKHTTKEIAKYLEDKNVDVIVGPEARGF
LFGVPVAHELDIGFVPVRKPGKLPYKTFSVDYALEYGSDSLEIHSDGIEKGQNVAIVDDL
LATGGTVLGVSKLVEKLGGHVSALNFVIELTELKGRDKLKGYDIQSLVKYDL