Protein Info for MMJJ_RS01555 in Methanococcus maripaludis JJ

Annotation: Na/Pi cotransporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 47 to 74 (28 residues), see Phobius details amino acids 84 to 91 (8 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 173 to 200 (28 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 9 to 310 (302 residues), 236.1 bits, see alignment E=3.6e-74 PF02690: Na_Pi_cotrans" amino acids 15 to 150 (136 residues), 177.7 bits, see alignment E=1.2e-56 amino acids 144 to 251 (108 residues), 57.8 bits, see alignment E=1.3e-19 PF01895: PhoU" amino acids 345 to 430 (86 residues), 58.4 bits, see alignment E=7.7e-20 amino acids 452 to 531 (80 residues), 63.3 bits, see alignment E=2.3e-21

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 99% identity to mmp:MMP0666)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>MMJJ_RS01555 Na/Pi cotransporter family protein (Methanococcus maripaludis JJ)
MEFALIAGVLGGLALFIYGMNLMGNGLQKVAGDGLKRLIEVLTKNKYLGVLVGTVVTMLI
QSSSATTVMVVGFVNASLMNLTQAIGVIMGANIGTTVTAQLVAFKLTDIAPLIVAIGVIM
QLVSKKRKHSDIAEVLIGFGILFIGMHTMSSVLKPLAAEPFFTNLLMDLENPVLGLFVGL
GMTLMIQSSSATIGLLIAVASTGALSLAVAFPILFGDNIGTCVTALLSSIGANRTAKRAA
LMHLIFNITGALIFMVLIYTTPLIPWIQSLSAGSVERQIANAHTIFNVTNTLIMLPFAGF
FVYAVEKLIPIKDYEKEFMPIKHLDSRIIMETPSIAVGLGVKEVVEMGKFVRENLRLSKE
ALVNKNVQSIKEVHEKEKIIDTMAHEITNHLIELSNQEISDSQKLKITSLISNVTSLERI
GDLAEDIVEHAENVIEDNIEFTNTAVDELNFMFDKVIVSIDTAIEAFETEDEVLVEKVTF
LEDEVDNLEKTFRKQHIKRLNAKECAPKASIVFLDIIGYLERISDHAVKIATGLEEEEFD
A