Protein Info for MMJJ_RS01485 in Methanococcus maripaludis JJ

Annotation: uracil-xanthine permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 322 to 324 (3 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details amino acids 362 to 379 (18 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 2 to 407 (406 residues), 328 bits, see alignment E=4.5e-102 PF00860: Xan_ur_permease" amino acids 2 to 379 (378 residues), 320.4 bits, see alignment E=7.1e-100

Best Hits

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 99% identity to mmp:MMP0681)

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>MMJJ_RS01485 uracil-xanthine permease family protein (Methanococcus maripaludis JJ)
MKRIALGFQHVLAMFGATVTVPLVVGYAIGLSMSEIALLLQAVLLAMGVATLLQTFAGSR
FPIVQGSSFAFIPGLIAVGSGMGLAAVEGALIIGGVIEAATGALGLIGKLKKLFSPIVTG
VTIMLIGFSLADVAVQYSFNYFADPAGSSIVTSILVAALTFITTILVSLQGKGTLKAMPV
IIGAVVGYVISMFLGLVDFSMMNQLSWFALPKLMPWGMPVFDVNAIIILLFAFMVSIIES
VGDYHAISTIADLKIDDNKINRGIASEGFSCTLAGLFGACGTTSYSENIGLVALTKVSSV
QVVQIGAVILVLLSMIPKFSGLLASIPAPVLGGLTTALYGMISITGLKLIKDKVELNDRN
TLILASALVLGLGAPQLPAEFLSLFPKIISSILESGMAVGAITAILMDQLLKK