Protein Info for MMJJ_RS01465 in Methanococcus maripaludis JJ

Annotation: METTL5 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF05175: MTS" amino acids 33 to 146 (114 residues), 32.3 bits, see alignment E=2.1e-11 PF03602: Cons_hypoth95" amino acids 41 to 143 (103 residues), 29.2 bits, see alignment E=2.1e-10 PF06325: PrmA" amino acids 46 to 101 (56 residues), 47.6 bits, see alignment E=5.2e-16 PF13847: Methyltransf_31" amino acids 48 to 122 (75 residues), 42 bits, see alignment E=2.5e-14 PF13649: Methyltransf_25" amino acids 49 to 116 (68 residues), 35 bits, see alignment E=5.6e-12 PF08241: Methyltransf_11" amino acids 51 to 123 (73 residues), 28.2 bits, see alignment E=7.4e-10

Best Hits

Swiss-Prot: 60% identical to Y284_METJA: Uncharacterized protein MJ0284 (MJ0284) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07579, putative methylase (inferred from 99% identity to mmp:MMP0685)

Predicted SEED Role

"Predicted RNA methylase COG2263"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>MMJJ_RS01465 METTL5 family protein (Methanococcus maripaludis JJ)
MKKRHLEILLDNLKPHPKPKAHLEQYSIEGNLASEFLLFAKEDIDGSFVIDLGCGSGRLI
IGAKVLGAEHAVGIDIDEETIDTAKENLKNLNVDSNSDLKVDFLNSDVKNIDKKYFEDNF
SDFNGLKKVVIQNPPFGSQKKYADRIFLDKAFEIGDVIYTIHNTATRDFLINYVKEKGRE
ITNIFQADFRIPAIYEFHKKKAVNVPVDIYRIV