Protein Info for MMJJ_RS01445 in Methanococcus maripaludis JJ

Annotation: O-phosphoserine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 TIGR00470: O-phosphoserine--tRNA ligase" amino acids 3 to 537 (535 residues), 854.2 bits, see alignment E=1.7e-261 PF01409: tRNA-synt_2d" amino acids 113 to 343 (231 residues), 186.6 bits, see alignment E=8.4e-59 PF17759: tRNA_synthFbeta" amino acids 182 to 316 (135 residues), 24.2 bits, see alignment E=3.1e-09 PF18006: SepRS_C" amino acids 426 to 465 (40 residues), 41.7 bits, see alignment 1.4e-14

Best Hits

Swiss-Prot: 99% identical to SEPS_METMP: O-phosphoserine--tRNA(Cys) ligase (sepS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K07587, O-phosphoseryl-tRNA synthetase [EC: 6.1.1.27] (inferred from 98% identity to mmz:MmarC7_1715)

MetaCyc: 68% identical to O-phosphoseryl-tRNA ligase monomer (Methanocaldococcus jannaschii)
RXN-10718 [EC: 6.1.1.27]

Predicted SEED Role

"O-phosphoseryl-tRNA(Cys) synthetase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>MMJJ_RS01445 O-phosphoserine--tRNA ligase (Methanococcus maripaludis JJ)
MFKREEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYL
RMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRPDVGLSDEKISQIEKLGIK
VSEHKESLQKILHGYKKGTLDGDDLVLEISNALEISSEMGLKILEEVFPEFKDLTAVSSK
LTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEG
VDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGV
YSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRDVASMVKLD
KVPVMDEIYDLTKELIDSCVKNKDLKSPCELTIEKTFSFGKTKKNVKINIFEKEECKNLL
GPSILNEIYVYDGNVIGIPESFDGVKEEFKDFLEKGKAEGVATGIRYIDALCFKITSKLE
EAFVSNTSEFKVKVPIVRSLSDINLKIDDIALKQIMSKNKVIDVRGPVFLNVEVKIE