Protein Info for MMJJ_RS01330 in Methanococcus maripaludis JJ

Annotation: cation-transporting P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 926 transmembrane" amino acids 56 to 76 (21 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 702 to 726 (25 residues), see Phobius details amino acids 732 to 753 (22 residues), see Phobius details amino acids 776 to 801 (26 residues), see Phobius details amino acids 813 to 834 (22 residues), see Phobius details amino acids 854 to 873 (20 residues), see Phobius details amino acids 885 to 905 (21 residues), see Phobius details PF00690: Cation_ATPase_N" amino acids 6 to 73 (68 residues), 62.4 bits, see alignment 6.3e-21 TIGR01494: HAD ATPase, P-type, family IC" amino acids 85 to 347 (263 residues), 130.8 bits, see alignment E=2.5e-42 amino acids 614 to 723 (110 residues), 94.3 bits, see alignment E=2.9e-31 PF00122: E1-E2_ATPase" amino acids 113 to 225 (113 residues), 97.5 bits, see alignment E=8.8e-32 PF00702: Hydrolase" amino acids 323 to 653 (331 residues), 50.1 bits, see alignment E=1.2e-16 PF13246: Cation_ATPase" amino acids 380 to 544 (165 residues), 136.4 bits, see alignment E=2.4e-43 PF00689: Cation_ATPase_C" amino acids 728 to 907 (180 residues), 135.3 bits, see alignment E=5.1e-43

Best Hits

KEGG orthology group: K01529, [EC: 3.6.1.-] (inferred from 98% identity to mmp:MMP0710)

Predicted SEED Role

"Cation-transporting ATPase, E1-E2 family"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (926 amino acids)

>MMJJ_RS01330 cation-transporting P-type ATPase (Methanococcus maripaludis JJ)
MLDTNYYLMPISEVFKKLDTEKSGLSNVEAENRLNTFGKNELNAEIRLPKWLKFLFQFKD
VFAAVLIFASAVSFLIGNYRDGTIMALIVIINAVIGYYQENKAENIMDSLKKLIQSPSKV
YRDGELKEISQGLLVVGDIVHLDEGDKVPADIRLIESYNLSTNDFSLTGESMPQEKDTEA
LDSEVGVADRTNMVYLGTNIATGNAKGVVVATGMATELGRIANLTREEKLAKSPLQVELS
NIANKITIFAVVIASILFLISLNQGLGLKFGLIYGLGIAVAIVPQALPMQITVALANGVS
KLAKKNAVIKKLSAVETLGSTNVITTDKTGTLTKNEITVRSIWFDGKEYEITGVGYEPKG
TILDASKNELDESGFSNIELIFNTATMASNAKIHEPDENHYGWYPIGDPTEAALITAARK
LNIMSLNEDEKYPKIQEFSFDSVRKRMSSIRLFNDKKMLMMKGALDSVLSVSKYIYKDGK
VVELKKEDIEMLNELNIQYSKKAMRVLAFAYRELENNGGEYSVENTEKDMVFLGLMAMSD
PPKEGVKDAIKKAHEAHIKTYIMTGDHAITAQAVGKQIFLADGGREVKVITGKELDSMPD
DELKQNMAENDALIFSRTSPENKLRIVKTLKEQGQIVAVTGDGVNDAPALKSSHIGVAMG
KIGTDVSKEASELILLDDSFTTLVYAIREGRTIYNNLTKTIIASLTSNGGELTIVLIGLL
AVAYMGWPMPILTIQILAIDLLAEILPLTALTFDPASRDIMNAPPRRKEEHVLNKYAISE
ILFFGFLMGFLAFLNFGLFIFRNDLELTQIAGVYPLATTISYSTIAFCQFMNILSRRYSY
ETLFSRTLFTNMNMIYSILISIVFTLTAIYVSPINKMIGFAPMGLVDWAYVLLASFVFLG
AHELLKVYKRHKKSGKHATVLTEIST