Protein Info for MMJJ_RS01325 in Methanococcus maripaludis JJ

Annotation: magnesium/cobalt transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 294 to 314 (21 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 32 to 352 (321 residues), 272.6 bits, see alignment E=2.5e-85 PF01544: CorA" amino acids 61 to 348 (288 residues), 237.4 bits, see alignment E=1.1e-74

Best Hits

Swiss-Prot: 40% identical to CORA_THEMA: Cobalt/magnesium transport protein CorA (corA) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 97% identity to mmp:MMP0711)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>MMJJ_RS01325 magnesium/cobalt transporter CorA (Methanococcus maripaludis JJ)
MRKIGSRYSKKAGLPPGDLVYTGEMELKETEIIFISYNADNFLKKQVKSLDEIIIDDLCV
NWIIFSGIPTAEEMRLIGERYELHKLTLEDILNTSQRTKFEVYEKYKYLVTRIIHQKVDT
VHLESEQLSIILKNNVLITFFEHDITILESLINRISNKSGSIREKKLDYLFYAVLDSIID
HYFAIISPIEDEIERYDSKLFSDIENEEIIHVKQIRQILVALRKNIGPFKEIFHKFSRDE
YEFIEKSNLIYIHDLYDHTVHLIETIDILKDNTSNIAEIHLSVMSNNMNEIMKVLTIIST
IFIPLSFVAGLYGMNFENMPELKWSFGYFYVLIVMGLVLTSMVMFFRRKRWI