Protein Info for MMJJ_RS01285 in Methanococcus maripaludis JJ

Annotation: CopG family ribbon-helix-helix protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF01402: RHH_1" amino acids 5 to 43 (39 residues), 26.8 bits, see alignment E=3.6e-10 PF08753: NikR_C" amino acids 57 to 126 (70 residues), 28.5 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 64% identical to Y767_METJA: Uncharacterized transcriptional regulator MJ0767 (MJ0767) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07722, CopG family transcriptional regulator, nickel-responsive regulator (inferred from 96% identity to mmp:MMP0719)

Predicted SEED Role

"Nickel responsive regulator NikR" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>MMJJ_RS01285 CopG family ribbon-helix-helix protein (Methanococcus maripaludis JJ)
MANVERISLSFPKFLLSELDSIVESKNYSSRSELIRDAVRKYVIENNALTPGKTVNGMIT
VVYSPSKDTMEEMSHIYFEYETIIKSMNQSYVKTTCEKNKKLEIFVIEGESDIVSEFYQK
IQNINGKIYDNIIIF