Protein Info for MMJJ_RS01275 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF12838: Fer4_7" amino acids 18 to 64 (47 residues), 31.2 bits, see alignment 3.8e-11 PF27217: AF_0155" amino acids 130 to 231 (102 residues), 114.3 bits, see alignment E=5.4e-37

Best Hits

KEGG orthology group: None (inferred from 94% identity to mmp:MMP0721)

Predicted SEED Role

"Ferredoxin 3 fused to uncharacterized domain" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>MMJJ_RS01275 4Fe-4S dicluster domain-containing protein (Methanococcus maripaludis JJ)
MAKFKIEIDSETCLGYKECGLCVSACEESIIIPDEKTGKVKVDKTREINCDGLGACLDVC
PVGALKITSDSGFSCGGHSGKPCPGSAVKSFNRSEQRSEMLQNKETESELLNWPVQLQLQ
LQLQLLNPNASYFKNADLIIAADCVPFAYPDFHNNLLKGKVLAIACPKLDDTKDYMLKIR
QIVEQNDIKNVTVAIMTVPCCSGLYSLVSRALNGLDVNITKKVISLDGKLMD