Protein Info for MMJJ_RS01270 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details PF12801: Fer4_5" amino acids 28 to 70 (43 residues), 36.4 bits, see alignment 8.2e-13 amino acids 112 to 148 (37 residues), 13 bits, see alignment 1.7e-05 PF00037: Fer4" amino acids 157 to 175 (19 residues), 23.9 bits, see alignment (E = 5.6e-09) PF12838: Fer4_7" amino acids 159 to 204 (46 residues), 30.1 bits, see alignment 1.1e-10 PF13187: Fer4_9" amino acids 159 to 205 (47 residues), 31.7 bits, see alignment 2.6e-11

Best Hits

KEGG orthology group: None (inferred from 94% identity to mmp:MMP0722)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>MMJJ_RS01270 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MQISKIRPFIQVLFFIIFLWTFISGQTQFWMVFVFLSIILAGIFGRYYCGFVCPINTIIH
PIQVLKDKTGFSSKNIPNLLKSEKPRLLIMLLFMVGLGITVNAMINGSRFPLPIIIISIG
VLTTLLSNENSWHRYLCPWGFLLSITGYFSKYGLNVTEKCISCKICENVCPAEAVKVENK
QNAEIFKKHCLLCLNCELKCPTNAITYKKL