Protein Info for MMJJ_RS01240 in Methanococcus maripaludis JJ

Annotation: excinuclease ABC subunit UvrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 TIGR00194: excinuclease ABC subunit C" amino acids 4 to 524 (521 residues), 512.5 bits, see alignment E=8.3e-158 PF01541: GIY-YIG" amino acids 11 to 86 (76 residues), 43.4 bits, see alignment E=5.2e-15 PF02151: UVR" amino acids 192 to 225 (34 residues), 22.4 bits, see alignment (E = 1.2e-08) PF08459: UvrC_RNaseH_dom" amino acids 366 to 514 (149 residues), 181.1 bits, see alignment E=2.1e-57

Best Hits

Swiss-Prot: 97% identical to UVRC_METMP: UvrABC system protein C (uvrC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 97% identity to mmp:MMP0728)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>MMJJ_RS01240 excinuclease ABC subunit UvrC (Methanococcus maripaludis JJ)
MINISDIPKNPGCYIYKNESGTVIYVGKAKNLKKRVSSYFNKKNHDPKTEKLVKSIYEME
FIVTDNEVEALILENTLIKKYSPKYNIDLKDSKNYAYIYISEENFPRIGISRNKSKKGKF
YGPFTSAKERDYVLDVLKKTFKIRSCKNMHKRPCLRHHIKNCTAPCSGDITSKDYLNQIK
KAEHVLKGHIDSLIDELKIEMDNKSKNLQFEEALLIREEINAIERLKTRQNVKRDVKYNE
DVISVLEKSGKLHIMVFNVLKGTLFDRKYFEFDYTENFFEEFLIQYYSENEVPSEIILSE
LPKNLEEDNNEYNSDAILEYLSKKKGSKVAFKIPKQGEKKQLLDLAIKNLEIYVNGNEIK
VQSLKNKLMLDKSPNVIECFDISHLSGTFTVGSMVQFRNGKPDKKNYRRFKIKTVSGIDD
FKSISEVVFRRYSKLIEENLELPDLIIIDGGKGQLSSAFSELRKLKLKIPLISIAKREEE
IYTPGIENPLPIKKNEKASLFIQEIRDEAHRFAINYNRLLKKKELIK