Protein Info for MMJJ_RS01070 in Methanococcus maripaludis JJ

Annotation: PadR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF03551: PadR" amino acids 14 to 82 (69 residues), 75.5 bits, see alignment E=2.6e-25 PF01638: HxlR" amino acids 26 to 84 (59 residues), 25.5 bits, see alignment E=9.4e-10

Best Hits

Swiss-Prot: 38% identical to YWZG_BACSU: Putative DNA-binding protein YwzG (ywzG) from Bacillus subtilis (strain 168)

KEGG orthology group: K10947, PadR family transcriptional regulator, regulatory protein PadR (inferred from 61% identity to cac:CA_C0571)

Predicted SEED Role

"Transcriptional regulator, PadR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>MMJJ_RS01070 PadR family transcriptional regulator (Methanococcus maripaludis JJ)
MDVQFKKGVLELCVLTLLNKRDYYGYELINEISKSISISEGTIYPLLRRLKADGLLTTYL
MESSSGPPRKYYKLTEKGKEVRESQAEEWIEFSKKVNELINSGVKDE